PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01367.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 350aa    MW: 39438.9 Da    PI: 6.5181
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01367.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.72.7e-184592148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd++l+ +v+++G g W+t +++ g++R++k+c++rw +yl
  Rsa1.0_01367.1_g00003.1 45 KGAWTPEEDQKLISYVNRHGEGGWRTLPEKAGLKRCGKSCRLRWANYL 92
                             79********************************************97 PP

2Myb_DNA-binding50.83.7e-1698142147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg ++++E+  ++ +++++G++ W++Iar ++ gRt++++k++w+++
  Rsa1.0_01367.1_g00003.1  98 RGEFSEDEERSIISLHALHGNK-WAAIARGLP-GRTDNEIKNYWNTH 142
                              899*******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.9434092IPR017930Myb domain
SuperFamilySSF466892.96E-2942139IPR009057Homeodomain-like
SMARTSM007171.6E-134494IPR001005SANT/Myb domain
PfamPF002491.1E-164592IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.1E-244699IPR009057Homeodomain-like
CDDcd001675.52E-104792No hitNo description
PROSITE profilePS5129424.89193147IPR017930Myb domain
SMARTSM007176.1E-1697145IPR001005SANT/Myb domain
PfamPF002494.7E-1598142IPR001005SANT/Myb domain
CDDcd001672.69E-11100143No hitNo description
Gene3DG3DSA:1.10.10.603.0E-25100148IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MSQVSITYKN DVVVGSHTYS YEHRINKDGV SSSKFLTLAE LGLKKGAWTP EEDQKLISYV  60
NRHGEGGWRT LPEKAGLKRC GKSCRLRWAN YLRPDIKRGE FSEDEERSII SLHALHGNKW  120
AAIARGLPGR TDNEIKNYWN THIKKRLIKK GVVPVTDKSI SEKVQDIREK RNVNQTITAS  180
DDLDHNEKVK KSGLSSARFL NRVANRFGKR INQSVLSEII GSGGPLPSHT TTSVTVDSES  240
DKSTSSSFTP TSNLLMTING NGNATSSPST FSDSSVNDHL MYCDNNEDNI GFSTFLNDKD  300
FMMLEDSCVE NTEFMKELTR FLQEDETDNV GMMPVYEHQD SFEEIDNYFA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28431475108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX9461840.0JX946184.1 Eruca vesicaria subsp. sativa MYB51 protein (MYB51-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009117607.11e-170PREDICTED: transcription factor MYB51-like
RefseqXP_013664615.11e-170PREDICTED: transcription factor MYB51-like
SwissprotO497821e-153MYB51_ARATH; Transcription factor MYB51
TrEMBLU5KK481e-176U5KK48_ERUSA; MYB51 protein
STRINGBra031035.1-P1e-170(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18570.11e-145myb domain protein 51